![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) ![]() |
![]() | Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
![]() | Protein automated matches [193326] (11 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:575584] [196867] (29 PDB entries) |
![]() | Domain d6jjqa1: 6jjq A:1-193 [365635] Other proteins in same PDB: d6jjqa2 automated match to d4qaja_ complexed with cl, na, peg |
PDB Entry: 6jjq (more details), 0.99 Å
SCOPe Domain Sequences for d6jjqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jjqa1 c.56.3.0 (A:1-193) automated matches {Acinetobacter baumannii [TaxId: 575584]} msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv pqamnqinaykpa
Timeline for d6jjqa1: