Lineage for d1b5va_ (1b5v A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924284Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2925293Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)
    Uniprot P00695
  8. 2925385Domain d1b5va_: 1b5v A: [36563]
    complexed with cl, na; mutant

Details for d1b5va_

PDB Entry: 1b5v (more details), 2.17 Å

PDB Description: contribution of hydrogen bonds to the conformational stability of human lysozyme: calorimetry and x-ray analysis of six ser->ala mutants
PDB Compounds: (A:) protein (lysozyme)

SCOPe Domain Sequences for d1b5va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5va_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdratdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d1b5va_:

Click to download the PDB-style file with coordinates for d1b5va_.
(The format of our PDB-style files is described here.)

Timeline for d1b5va_: