Lineage for d6ckka_ (6ckk A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. Protein CMP acylneuraminate synthetase [53456] (2 species)
    a sialic acid activating synthetase
  7. Species Neisseria meningitidis [TaxId:487] [53457] (6 PDB entries)
  8. Domain d6ckka_: 6ckk A: [365626]
    automated match to d1eyra_
    complexed with ca, ctp

Details for d6ckka_

PDB Entry: 6ckk (more details), 1.8 Å

PDB Description: n. meningitidis cmp-sialic acid synthetase in the presence of ctp and ca2+
PDB Compounds: (A:) N-acylneuraminate cytidylyltransferase

SCOPe Domain Sequences for d6ckka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ckka_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]}
mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
ndtaslianncffiaptklyimshqdsididteldlqqaenilnh

SCOPe Domain Coordinates for d6ckka_ are not available.

Timeline for d6ckka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ckkb_