Lineage for d6ixra_ (6ixr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340598Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2340599Family a.118.27.1: DIL domains from class V myosins [310651] (6 proteins)
  6. 2340630Protein automated matches [310888] (3 species)
    not a true protein
  7. 2340631Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311398] (6 PDB entries)
  8. 2340636Domain d6ixra_: 6ixr A: [365624]
    automated match to d2f6hx_
    complexed with so4

Details for d6ixra_

PDB Entry: 6ixr (more details), 2.85 Å

PDB Description: structure of myo2-gtd in complex with inp2
PDB Compounds: (A:) Myosin-2

SCOPe Domain Sequences for d6ixra_:

Sequence, based on SEQRES records: (download)

>d6ixra_ a.118.27.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
natqineelyrlledteilnqeitegllkgfevpdagvaiqlskrdvvypariliivlse
mwrfgltkqsesflaqvlttiqkvvtqlkgndlipsgvfwlanvrelysfvvfalnsilt
eetfkngmtdeeykeyvslvtelkddfealsyniyniwlkklqkqlqkkainavvisesl
pgfsagetsganteeytmddiltffnsiywcmksfhienevfhavvttllnyvdaicfne
limkrnflswkrglqlnynvtrleewckthgltdgteclqhliqtakllqvrkytiedid
ilrgicysltpaqlqklisqyqvadyespipqeilryvadivkkeaalsssgndskgheh
sssifitpetgpftdpfsliktrkfdqveayipawlslpstkrivdlvaqqvvq

Sequence, based on observed residues (ATOM records): (download)

>d6ixra_ a.118.27.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
natqineelyrlledteilnqeitegllkgfevpdagvaiqlskrdvvypariliivlse
mwrfgltkqsesflaqvlttiqkvvtqlkgndlipsgvfwlanvrelysfvvfalnsilt
eetfkngmtdeeykeyvslvtelkddfealsyniyniwlkklqkqlqkkainavvisese
ytmddiltffnsiywcmksfhienevfhavvttllnyvdaicfnelimkrnflswkrglq
lnynvtrleewckthgltdgteclqhliqtakllqvrkytiedidilrgicysltpaqlq
klisqyqvadyespipqeilryvadivkkeaalssssifitpetgpftdpfsliktrkfd
qveayipawlslpstkrivdlvaqqvvq

SCOPe Domain Coordinates for d6ixra_:

Click to download the PDB-style file with coordinates for d6ixra_.
(The format of our PDB-style files is described here.)

Timeline for d6ixra_: