Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [272712] (16 PDB entries) |
Domain d6d7mb_: 6d7m B: [365594] automated match to d1un0a_ complexed with cl, edo, sin; mutant |
PDB Entry: 6d7m (more details), 2.19 Å
SCOPe Domain Sequences for d6d7mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d7mb_ a.118.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktd cspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavralgniagd gsafrdlvikhgaidpllallavpdlstlacgylrnltrtlsnlcrnknpappldaveqi lptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtp alraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqq vvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsak dtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnli ekyf
Timeline for d6d7mb_: