SCOPe 2.07: Domain d5amfa1: 5amf A:24-142

Lineage for d5amfa1 (5amf A:24-142)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d5amfa1: 5amf A:24-142 [365588]
   Other proteins in same PDB: d5amfa2
   automated match to d5i7xa_
   complexed with na, twl

Details for d5amfa1

PDB Entry: 5amf, 1.75 Å

PDB Description: crystal structure of the bromodomain of human surface epitope engineered brd1a in complex with 3d consortium fragment ethyl 4,5,6, 7- tetrahydro-1h-indazole-5-carboxylate (sgc - diamond i04-1 fragment screening)

PDB Compounds: (A:) Bromodomain-containing protein 1

SCOPe Domain Sequences for d5amfa1:

Sequence; same for both SEQRES and ATOM records:

>d5amfa1 a.29.2.0 (A:24-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqvamelrlteltrllrsvldqlqdkdparifaqpvslkevpdyldhikhpmdfatmrkr
leaqgyknlhefeedfdliidncmkynardtvfyraavrlrdqggvvlrqarrevdsig

Timeline for d5amfa1:

• d5amfa1 is new in SCOPe 2.07-stable
  
• d5amfa1 appears in the current release, SCOPe 2.08