SCOPe 2.07: Domain d6aa5a1: 6aa5 A:3-156

Lineage for d6aa5a1 (6aa5 A:3-156)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)

8. Domain d6aa5a1: 6aa5 A:3-156 [365586]
   Other proteins in same PDB: d6aa5a2
   automated match to d5ghja_
   complexed with mku, so4, zn

Details for d6aa5a1

PDB Entry: 6aa5, 1.9 Å

PDB Description: crystal structure of mth1 in complex with 3-isomangostin

PDB Compounds: (A:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d6aa5a1:

Sequence; same for both SEQRES and ATOM records:

>d6aa5a1 d.113.1.1 (A:3-156) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv

Timeline for d6aa5a1:

• d6aa5a1 is new in SCOPe 2.07-stable
  
• d6aa5a1 appears in the current release, SCOPe 2.08