Lineage for d1rem__ (1rem -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 323287Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 323288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 323297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 323347Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tussues ans secretions
  7. 323554Species Human (Homo sapiens) [TaxId:9606] [53969] (202 PDB entries)
  8. 323755Domain d1rem__: 1rem - [36558]
    complexed with hp3, man, nag, no3

Details for d1rem__

PDB Entry: 1rem (more details), 2.1 Å

PDB Description: human lysozyme with man-b1,4-glcnac covalently attached to asp53

SCOP Domain Sequences for d1rem__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rem__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1rem__:

Click to download the PDB-style file with coordinates for d1rem__.
(The format of our PDB-style files is described here.)

Timeline for d1rem__: