Lineage for d5zqlb_ (5zql B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. Protein automated matches [190123] (156 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186862] (206 PDB entries)
  8. Domain d5zqlb_: 5zql B: [365571]
    automated match to d4l16a_

Details for d5zqlb_

PDB Entry: 5zql (more details), 3.01 Å

PDB Description: crystal structure of human katanin aaa atpase domain
PDB Compounds: (B:) Katanin p60 ATPase-containing subunit A1

SCOPe Domain Sequences for d5zqlb_:

Sequence, based on SEQRES records: (download)

>d5zqlb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vealerdiisqnpnvrwddiadlveakkllkeavvlpmwmpeffkgirrpwkgvlmvgpp
gtgktllakavateckttffnvssstltskyrgeseklvrllfemarfyspatifidqid
sicsrrgtseeheasrrvkaellvqmdgvggtsenddpskmvmvlaatnfpwdidealrr
rlekriyiplpsakgreellrislreleladdvdlasiaenmegysgaditnvcrdaslm
amrrriegltpeeirnlskeemhmpttmedfemalkkvsksvsaadieryekwifefgsc

Sequence, based on observed residues (ATOM records): (download)

>d5zqlb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vealerdiisqnpnvrwddiadlveakkllkeavvlpmwmpeffkgirrpwkgvlmvgpp
gtgktllakavateckttffnvssstltskyrgeseklvrllfemarfyspatifidqid
sicseheasrrvkaellvqmmvmvlaatnfpwdidealrrrlekriyiplpsakgreell
rislrdlasiaenmegysgaditnvcrdaslmamrrriegltpetmedfemalkkvsksv
saadieryekwifefgsc

SCOPe Domain Coordinates for d5zqlb_ are not available.

Timeline for d5zqlb_:

Domains from other chains:
(mouse over for more information)
d5zqla_