Lineage for d1b7pa_ (1b7p A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1013457Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1013515Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1013839Species Human (Homo sapiens) [TaxId:9606] [53969] (208 PDB entries)
    Uniprot P00695
  8. 1014012Domain d1b7pa_: 1b7p A: [36551]
    complexed with na; mutant

Details for d1b7pa_

PDB Entry: 1b7p (more details), 2 Å

PDB Description: verification of spmp using mutant human lysozymes
PDB Compounds: (A:) protein (lysozyme)

SCOPe Domain Sequences for d1b7pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7pa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnacglscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d1b7pa_:

Click to download the PDB-style file with coordinates for d1b7pa_.
(The format of our PDB-style files is described here.)

Timeline for d1b7pa_: