Lineage for d6nm6e_ (6nm6 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757875Domain d6nm6e_: 6nm6 E: [365507]
    Other proteins in same PDB: d6nm6h2, d6nm6l2, d6nm6v_
    automated match to d2rhea_
    complexed with nag

Details for d6nm6e_

PDB Entry: 6nm6 (more details), 2.74 Å

PDB Description: crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to n6 fr3-03 scfv in complex with crystallization chaperones 3h109l fab and 35o22 scfv at 3.2 angstrom
PDB Compounds: (E:) 35O22 scFv light chain

SCOPe Domain Sequences for d6nm6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nm6e_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgis
prfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkvsvlg

SCOPe Domain Coordinates for d6nm6e_:

Click to download the PDB-style file with coordinates for d6nm6e_.
(The format of our PDB-style files is described here.)

Timeline for d6nm6e_: