SCOP 1.75: Domain d1b5xa_: 1b5x A:

Lineage for d1b5xa_ (1b5x A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (11 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (205 PDB entries)
   Uniprot P00695

8. Domain d1b5xa_: 1b5x A: [36550]
   complexed with na; mutant

Details for d1b5xa_

PDB Entry: 1b5x, 2 Å

PDB Description: Contribution of hydrogen bonds to the conformational stability of human lysozyme: calorimetry and x-ray analysis of six ser->ala mutants

PDB Compounds: (A:) protein (lysozyme)

SCOP Domain Sequences for d1b5xa_:

Sequence; same for both SEQRES and ATOM records:

>d1b5xa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlacsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1b5xa_:

• d1b5xa_ first appeared (with stable ids) in SCOP 1.55
  
• d1b5xa_ appears in SCOP 1.73
  
• d1b5xa_ appears in SCOPe 2.01
  
• d1b5xa_ appears in the current release, SCOPe 2.08