![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) ![]() |
![]() | Family b.42.5.1: Fascin [50406] (1 protein) automatically mapped to Pfam PF06268 |
![]() | Protein Fascin [50407] (1 species) duplication: tandem repeat of four domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries) |
![]() | Domain d6i14a3: 6i14 A:260-382 [365496] automated match to d1dfca3 complexed with act, gzn |
PDB Entry: 6i14 (more details), 1.73 Å
SCOPe Domain Sequences for d6i14a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i14a3 b.42.5.1 (A:260-382) Fascin {Human (Homo sapiens) [TaxId: 9606]} caqvvlqaanernvstrqgmdlsanqdeetdqetfqleidrdtkkcafrthtgkywtlta tggvqstassknascyfdiewrdrritlrasngkfvtskkngqlaasvetagdselflmk lin
Timeline for d6i14a3: