Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein automated matches [190304] (16 species) not a true protein |
Species Azotobacter vinelandii [TaxId:322710] [365462] (1 PDB entry) |
Domain d6q93e_: 6q93 E: [365478] automated match to d2afhe_ complexed with adp, mg, sf4 |
PDB Entry: 6q93 (more details), 2.2 Å
SCOPe Domain Sequences for d6q93e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q93e_ c.37.1.10 (E:) automated matches {Azotobacter vinelandii [TaxId: 322710]} alrqcaiygkggigkstttqnlvaalaeagkkvmivgcdpkadstrlilhskaqgtvmem aasagsvedleledvlqigfggvkcvesggpepgvgcagrgvitainfleeegaysddld fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniakgivkyahsgsvrlg glicnsrktdredelimalaakigtqmihfvprdnvvqhaeirrmtvieydpkagqadey ralarkivdnkllvipnpasmeeleellmefgime
Timeline for d6q93e_: