Lineage for d6ildb2 (6ild B:222-575)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574631Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2574632Protein automated matches [226887] (24 species)
    not a true protein
  7. 2574692Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)
  8. 2574698Domain d6ildb2: 6ild B:222-575 [365449]
    Other proteins in same PDB: d6ilda1, d6ildb1
    automated match to d3bjua2
    protein/RNA complex; complexed with 45a, gol, lys, mg

Details for d6ildb2

PDB Entry: 6ild (more details), 1.88 Å

PDB Description: crystal structure of human lysrs: p38/aimp2 complex ii
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6ildb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ildb2 d.104.1.0 (B:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

SCOPe Domain Coordinates for d6ildb2:

Click to download the PDB-style file with coordinates for d6ildb2.
(The format of our PDB-style files is described here.)

Timeline for d6ildb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ildb1