SCOPe 2.08: Domain d6ildb2: 6ild B:222-575

Lineage for d6ildb2 (6ild B:222-575)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)

8. Domain d6ildb2: 6ild B:222-575 [365449]
   Other proteins in same PDB: d6ilda1, d6ildb1
   automated match to d3bjua2
   protein/RNA complex; complexed with 45a, gol, lys, mg

Details for d6ildb2

PDB Entry: 6ild, 1.88 Å

PDB Description: crystal structure of human lysrs: p38/aimp2 complex ii

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6ildb2:

Sequence; same for both SEQRES and ATOM records:

>d6ildb2 d.104.1.0 (B:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

Timeline for d6ildb2:

• d6ildb2 first appeared in SCOPe 2.07