SCOPe 2.08: Domain d6njrb1: 6njr B:64-234

Lineage for d6njrb1 (6njr B:64-234)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (16 PDB entries)

8. Domain d6njrb1: 6njr B:64-234 [365438]
   Other proteins in same PDB: d6njra2, d6njra3, d6njrb2, d6njrb3
   automated match to d1ja1a2
   complexed with fad, fmn, nap; mutant

Details for d6njrb1

PDB Entry: 6njr, 2.7 Å

PDB Description: spin-labeled t177c/a637c mutant of rat cypor

PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d6njrb1:

Sequence; same for both SEQRES and ATOM records:

>d6njrb1 c.23.5.0 (B:64-234) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladls
slpeidkslvvfamatygegdptdnaqdfydwlqetdvdltgvkfavfglgnkcyehfna
mgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavaeffgve

Timeline for d6njrb1:

• d6njrb1 first appeared in SCOPe 2.07