Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
Protein automated matches [190696] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [365254] (1 PDB entry) |
Domain d6e3br_: 6e3b R: [365425] automated match to d1xria_ complexed with so4 |
PDB Entry: 6e3b (more details), 2.5 Å
SCOPe Domain Sequences for d6e3br_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e3br_ c.45.1.1 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw
Timeline for d6e3br_: