Lineage for d6nbqh_ (6nbq H:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018743Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 3018744Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 3018909Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 3018910Protein automated matches [191173] (18 species)
    not a true protein
  7. 3019027Species Thermosynechococcus elongatus [TaxId:197221] [365420] (4 PDB entries)
  8. 3019031Domain d6nbqh_: 6nbq H: [365422]
    Other proteins in same PDB: d6nbqd_
    automated match to d3iam4_
    complexed with sf4

Details for d6nbqh_

PDB Entry: 6nbq (more details), 3.1 Å

PDB Description: t.elongatus ndh (data-set 1)
PDB Compounds: (H:) NAD(P)H-quinone oxidoreductase subunit H

SCOPe Domain Sequences for d6nbqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nbqh_ e.18.1.0 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
kietrtepmvinmgphhpsmhgvlrlmvtldgedvidcepvigylhrgmekiaenrtnim
fipyvsrwdyaagmfneavtvnapeklagipvpkrasyirvimlelnrianhllwlgpfl
advgaqtpffyifrereyiydlfeaatgmrfinnnyfriggvaadltygwvtkcrdfcdy
flpkvdeyerlitnnpifvrrlqgvgkisreeainwglsgpmlrasgvkwdlrkvdhyec
yddfdwdvpvategdclaryivriqemresvkiirqaldglpggpyenleakrmlegaks
ewngfdyqyigkklsptfkipkgehyvrvesgkgelgiyligddnvfpwrwkirppdfnn
lqvlpqllkgmkvadivailgsidvimgsvdr

SCOPe Domain Coordinates for d6nbqh_:

Click to download the PDB-style file with coordinates for d6nbqh_.
(The format of our PDB-style files is described here.)

Timeline for d6nbqh_: