Lineage for d6i17a1 (6i17 A:10-140)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792682Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. 2792683Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. 2792684Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. 2792685Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries)
  8. 2792698Domain d6i17a1: 6i17 A:10-140 [365404]
    automated match to d1dfca1
    complexed with act, edo, gzw

Details for d6i17a1

PDB Entry: 6i17 (more details), 1.56 Å

PDB Description: crystal structure of fascin in complex with compound 24
PDB Compounds: (A:) fascin

SCOPe Domain Sequences for d6i17a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i17a1 b.42.5.1 (A:10-140) Fascin {Human (Homo sapiens) [TaxId: 9606]}
vqiqfglincgnkyltaeafgfkvnasasslkkkqiwtleqppdeagsaavclrshlgry
laadkdgnvtcerevpgpdcrflivahddgrwslqseahrryfggtedrlscfaqtvspa
ekwsvhiamhp

SCOPe Domain Coordinates for d6i17a1:

Click to download the PDB-style file with coordinates for d6i17a1.
(The format of our PDB-style files is described here.)

Timeline for d6i17a1: