Lineage for d2bqo__ (2bqo -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 323287Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 323288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 323297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 323347Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tussues ans secretions
  7. 323554Species Human (Homo sapiens) [TaxId:9606] [53969] (202 PDB entries)
  8. 323714Domain d2bqo__: 2bqo - [36538]
    complexed with na; mutant

Details for d2bqo__

PDB Entry: 2bqo (more details), 1.8 Å

PDB Description: contribution of hydrophobic effect to the conformational stability of human lysozyme
PDB Compounds: ( :)

SCOP Domain Sequences for d2bqo__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bqo__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnaahlscsallqdniadavaaakravrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d2bqo__:

Click to download the PDB-style file with coordinates for d2bqo__.
(The format of our PDB-style files is described here.)

Timeline for d2bqo__: