Lineage for d6i10a2 (6i10 A:141-259)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792682Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. 2792683Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. 2792684Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. 2792685Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries)
  8. 2792767Domain d6i10a2: 6i10 A:141-259 [365375]
    automated match to d1dfca2
    complexed with act, edo, gzk

Details for d6i10a2

PDB Entry: 6i10 (more details), 2.1 Å

PDB Description: crystal structure of fascin in complex with compound 2
PDB Compounds: (A:) fascin

SCOPe Domain Sequences for d6i10a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i10a2 b.42.5.1 (A:141-259) Fascin {Human (Homo sapiens) [TaxId: 9606]}
qvniysvtrkryahlsarpadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdg
rlvarpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkatkvgkdelfaleqs

SCOPe Domain Coordinates for d6i10a2:

Click to download the PDB-style file with coordinates for d6i10a2.
(The format of our PDB-style files is described here.)

Timeline for d6i10a2: