![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
![]() | Protein automated matches [190457] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries) |
![]() | Domain d6h5ta1: 6h5t A:741-801 [365372] Other proteins in same PDB: d6h5ta2, d6h5tb2 automated match to d2j6ka_ complexed with 7pg, act, cl, zn |
PDB Entry: 6h5t (more details), 1.69 Å
SCOPe Domain Sequences for d6h5ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h5ta1 b.34.2.0 (A:741-801) automated matches {Human (Homo sapiens) [TaxId: 9606]} kvvyyralypfesrshdeitiqpgdivmvdesqtgepgwlggelkgktgwfpanyaekip e
Timeline for d6h5ta1: