SCOPe 2.08: Domain d6h3ul1: 6h3u L:1-109

Lineage for d6h3ul1 (6h3u L:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d6h3ul1: 6h3u L:1-109 [365365]
   Other proteins in same PDB: d6h3ul2
   automated match to d1igml_

Details for d6h3ul1

PDB Entry: 6h3u, 3.17 Å

PDB Description: schmallenberg virus glycoprotein gc head domain in complex with scfv 4b6

PDB Compounds: (L:) scFv 4B6 VL

SCOPe Domain Sequences for d6h3ul1:

Sequence; same for both SEQRES and ATOM records:

>d6h3ul1 b.1.1.1 (L:1-109) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscsasqgisyylnwyqqkpdgtvklliyytsslhsgvps
rfsgsgsgtdysltisnlepediatyycqqysklpwtfgggtkleikgg

Timeline for d6h3ul1:

• d6h3ul1 first appeared in SCOPe 2.07