Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries) |
Domain d6ilhb1: 6ilh B:72-221 [365353] Other proteins in same PDB: d6ilha2, d6ilhb2 automated match to d3bjua1 complexed with kaa; mutant |
PDB Entry: 6ilh (more details), 2.5 Å
SCOPe Domain Sequences for d6ilhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ilhb1 b.40.4.0 (B:72-221) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt kkgelsiipyeitllspclhmlphlhfglk
Timeline for d6ilhb1: