Lineage for d1i1za_ (1i1z A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28961Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries)
  8. 29074Domain d1i1za_: 1i1z A: [36534]

Details for d1i1za_

PDB Entry: 1i1z (more details), 1.8 Å

PDB Description: mutant human lysozyme (q86d)

SCOP Domain Sequences for d1i1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1za_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallddniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1i1za_:

Click to download the PDB-style file with coordinates for d1i1za_.
(The format of our PDB-style files is described here.)

Timeline for d1i1za_: