Lineage for d6h3ti_ (6h3t I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760520Domain d6h3ti_: 6h3t I: [365326]
    Other proteins in same PDB: d6h3tl_, d6h3tm_
    automated match to d5i0za_

Details for d6h3ti_

PDB Entry: 6h3t (more details), 2.84 Å

PDB Description: schmallenberg virus glycoprotein gc head domain in complex with scfv 1c11
PDB Compounds: (I:) scFv 1C11 VH

SCOPe Domain Sequences for d6h3ti_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h3ti_ b.1.1.0 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasvkvsckasgysftdynmcwvkqshgkslewigyidpyngltsy
npkfkgkatltvdkssstafmhlnsltsedsavyycarnyygrsyamdywgqgtsvtv

SCOPe Domain Coordinates for d6h3ti_:

Click to download the PDB-style file with coordinates for d6h3ti_.
(The format of our PDB-style files is described here.)

Timeline for d6h3ti_: