Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries) |
Domain d6hojb_: 6hoj B: [365308] automated match to d3waoa_ complexed with edo, so4 |
PDB Entry: 6hoj (more details), 1.51 Å
SCOPe Domain Sequences for d6hojb_:
Sequence, based on SEQRES records: (download)
>d6hojb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nsftligeasdgsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkk kylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyi aysde
>d6hojb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nsftligeassmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkky lvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiay sde
Timeline for d6hojb_: