Lineage for d6h3ui_ (6h3u I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745152Domain d6h3ui_: 6h3u I: [365302]
    Other proteins in same PDB: d6h3ul2
    automated match to d2dqhh1

Details for d6h3ui_

PDB Entry: 6h3u (more details), 3.17 Å

PDB Description: schmallenberg virus glycoprotein gc head domain in complex with scfv 4b6
PDB Compounds: (I:) scFv 4B6 VH

SCOPe Domain Sequences for d6h3ui_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h3ui_ b.1.1.1 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qmqlqesgpglvkpsqslsltctvtgysitsdsawnwirqfpgnklewmgyisysgstsy
npslksrisitrdtsknqfflqlnsvttedtatyyctrwgdgyylywyfdvwgagttvtv
ss

SCOPe Domain Coordinates for d6h3ui_:

Click to download the PDB-style file with coordinates for d6h3ui_.
(The format of our PDB-style files is described here.)

Timeline for d6h3ui_: