Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [226581] (5 PDB entries) |
Domain d6djnd1: 6djn D:4-146 [365295] Other proteins in same PDB: d6djna2, d6djnb2, d6djnc2, d6djnd2 automated match to d1c0fa1 complexed with adp, mg, po4 |
PDB Entry: 6djn (more details), 3.1 Å
SCOPe Domain Sequences for d6djnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6djnd1 c.55.1.0 (D:4-146) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim fetfnvpamyvaiqavlslyasg
Timeline for d6djnd1: