Lineage for d6djnd1 (6djn D:4-146)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. Protein automated matches [226839] (64 species)
    not a true protein
  7. Species Chicken (Gallus gallus) [TaxId:9031] [226581] (5 PDB entries)
  8. Domain d6djnd1: 6djn D:4-146 [365295]
    Other proteins in same PDB: d6djna2, d6djnb2, d6djnc2, d6djnd2
    automated match to d1c0fa1
    complexed with adp, mg, po4

Details for d6djnd1

PDB Entry: 6djn (more details), 3.1 Å

PDB Description: cryo-em structure of adp-pi-actin filaments
PDB Compounds: (D:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6djnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6djnd1 c.55.1.0 (D:4-146) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

SCOPe Domain Coordinates for d6djnd1 are not available.

Timeline for d6djnd1:

Domains from same chain:
(mouse over for more information)
d6djnd2
Domains from other chains:
(mouse over for more information)
d6djna1, d6djna2, d6djnb1, d6djnb2, d6djnc1, d6djnc2