Lineage for d6gals_ (6gal S:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019205Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 3019206Protein automated matches [191172] (11 species)
    not a true protein
  7. 3019254Species Escherichia coli [TaxId:83333] [351202] (9 PDB entries)
  8. 3019259Domain d6gals_: 6gal S: [365287]
    Other proteins in same PDB: d6gall_, d6galm_
    automated match to d3rgws_
    complexed with cl, cxs, ej2, f3s, li, mg, sf3, sf4, so4

Details for d6gals_

PDB Entry: 6gal (more details), 1.25 Å

PDB Description: structure of fully reduced hydrogenase (hyd-1) variant e28q collected at ph 10
PDB Compounds: (S:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d6gals_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gals_ e.19.1.0 (S:) automated matches {Escherichia coli [TaxId: 83333]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrv

SCOPe Domain Coordinates for d6gals_:

Click to download the PDB-style file with coordinates for d6gals_.
(The format of our PDB-style files is described here.)

Timeline for d6gals_: