Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
Protein automated matches [191172] (11 species) not a true protein |
Species Escherichia coli [TaxId:83333] [351202] (9 PDB entries) |
Domain d6fpwt_: 6fpw T: [365283] Other proteins in same PDB: d6fpwl_, d6fpwm_ automated match to d3rgws_ complexed with cl, ej2, f3s, lmt, mg, sf3, sf4, so4 |
PDB Entry: 6fpw (more details), 1.35 Å
SCOPe Domain Sequences for d6fpwt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fpwt_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 83333]} kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi qsghgclgcaengfwdrgsfysrv
Timeline for d6fpwt_: