Lineage for d6djnb2 (6djn B:147-375)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491727Protein automated matches [226905] (13 species)
    not a true protein
  7. 2491730Species Chicken (Gallus gallus) [TaxId:9031] [226582] (4 PDB entries)
  8. 2491741Domain d6djnb2: 6djn B:147-375 [365274]
    Other proteins in same PDB: d6djna1, d6djnb1, d6djnc1, d6djnd1
    automated match to d1c0fa2
    complexed with adp, mg, po4

Details for d6djnb2

PDB Entry: 6djn (more details), 3.1 Å

PDB Description: cryo-em structure of adp-pi-actin filaments
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6djnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6djnb2 c.55.1.1 (B:147-375) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

SCOPe Domain Coordinates for d6djnb2:

Click to download the PDB-style file with coordinates for d6djnb2.
(The format of our PDB-style files is described here.)

Timeline for d6djnb2: