SCOPe 2.07: Domain d6f9oa1: 6f9o A:1-303

Lineage for d6f9oa1 (6f9o A:1-303)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Psychrobacter cryohalolentis [TaxId:335284] [365263] (1 PDB entry)

8. Domain d6f9oa1: 6f9o A:1-303 [365264]
   Other proteins in same PDB: d6f9oa2
   automated match to d4mj3b_
   complexed with cl, na, peg

Details for d6f9oa1

PDB Entry: 6f9o, 1.05 Å

PDB Description: crystal structure of cold-adapted haloalkane dehalogenase dpca from psychrobacter cryohalolentis k5

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d6f9oa1:

Sequence; same for both SEQRES and ATOM records:

>d6f9oa1 c.69.1.0 (A:1-303) automated matches {Psychrobacter cryohalolentis [TaxId: 335284]}
mkilrtpdsrfanlpdynfdphylmvddsedselrvhyldegprdadpvlllhgepswcy
lyrkmipiltaaghrviapdlpgfgrsdkpasrtdytyqrhvnwmqsvldqldlnnitlf
cqdwggliglrlvaenpdrfarvaagntmlptgdhdlgegfrkwqqfsqeipqfhvggti
ksgtvtklsqavidaynapfpdesykegarqfpllvpstpddpasennraawielskwtk
pfitlfsdsdpvtaggdrimqkiipgtkgqahttiangghflqedqgekvakllvqfihd
npr

Timeline for d6f9oa1:

• d6f9oa1 is new in SCOPe 2.07-stable
  
• d6f9oa1 appears in the current release, SCOPe 2.08