Lineage for d6cf1b_ (6cf1 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. Protein Antitoxin HigA [158465] (2 species)
    Uncharacterized transcriptional regulator YddM
  7. Species Proteus vulgaris [TaxId:585] [229675] (3 PDB entries)
  8. Domain d6cf1b_: 6cf1 B: [365258]
    automated match to d4mcxa_
    complexed with k

Details for d6cf1b_

PDB Entry: 6cf1 (more details), 1.9 Å

PDB Description: proteus vulgaris higa antitoxin structure
PDB Compounds: (B:) antitoxin higa

SCOPe Domain Sequences for d6cf1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cf1b_ a.35.1.3 (B:) Antitoxin HigA {Proteus vulgaris [TaxId: 585]}
vshpgemiardledmgvsgrrfahnigvtpatvsrllagktaltpslsiriaaalgstpe
fwlrlqsnydlrqlenqidtsgivlygesneqqq

SCOPe Domain Coordinates for d6cf1b_ are not available.

Timeline for d6cf1b_:

Domains from other chains:
(mouse over for more information)
d6cf1a_