Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [226581] (5 PDB entries) |
Domain d6djmb1: 6djm B:4-146 [365252] Other proteins in same PDB: d6djma2, d6djmb2, d6djmc2, d6djmd2 automated match to d1c0fa1 complexed with anp, mg |
PDB Entry: 6djm (more details), 3.1 Å
SCOPe Domain Sequences for d6djmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6djmb1 c.55.1.0 (B:4-146) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim fetfnvpamyvaiqavlslyasg
Timeline for d6djmb1: