Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Azurin [49530] (6 species) |
Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries) Uniprot P00282 |
Domain d6mjsb_: 6mjs B: [365221] Other proteins in same PDB: d6mjsa2 automated match to d4k9ja_ complexed with cu, req |
PDB Entry: 6mjs (more details), 1.85 Å
SCOPe Domain Sequences for d6mjsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mjsb_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvvtd gmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegeqfmffctfpghsalmw gwlhlk
Timeline for d6mjsb_:
View in 3D Domains from other chains: (mouse over for more information) d6mjsa1, d6mjsa2, d6mjsc_, d6mjsd_ |