Lineage for d5yy5l_ (5yy5 L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369093Domain d5yy5l_: 5yy5 L: [365217]
    automated match to d4v1de_
    complexed with nag

Details for d5yy5l_

PDB Entry: 5yy5 (more details), 2.8 Å

PDB Description: structural definition of a unique neutralization epitope on the receptor-binding domain of mers-cov spike glycoprotein
PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d5yy5l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yy5l_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsqpvltqspsasgtpgqrvtiscsgsssnignnyvywyqqlpgtapklliywndqrpsg
vpdrfsgsksgtsaslaisglrsedeadyycaawddslsgavfgggtqltvl

SCOPe Domain Coordinates for d5yy5l_:

Click to download the PDB-style file with coordinates for d5yy5l_.
(The format of our PDB-style files is described here.)

Timeline for d5yy5l_: