Lineage for d5yy5l_ (5yy5 L:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d5yy5l_: 5yy5 L: [365217]
    Other proteins in same PDB: d5yy5h_
    automated match to d4v1de_
    complexed with nag

Details for d5yy5l_

PDB Entry: 5yy5 (more details), 2.8 Å

PDB Description: structural definition of a unique neutralization epitope on the receptor-binding domain of mers-cov spike glycoprotein
PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d5yy5l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yy5l_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsqpvltqspsasgtpgqrvtiscsgsssnignnyvywyqqlpgtapklliywndqrpsg
vpdrfsgsksgtsaslaisglrsedeadyycaawddslsgavfgggtqltvl

SCOPe Domain Coordinates for d5yy5l_ are not available.

Timeline for d5yy5l_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5yy5c_, d5yy5d_, d5yy5h_