SCOPe 2.08: Domain d5uf4b_: 5uf4 B:

Lineage for d5uf4b_ (5uf4 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (18 PDB entries)

8. Domain d5uf4b_: 5uf4 B: [365211]
   automated match to d3e6ja_

Details for d5uf4b_

PDB Entry: 5uf4, 2.04 Å

PDB Description: crystal structure of variable lymphocyte receptor (vlr) o13 with lnnt bound

PDB Compounds: (B:) o13

SCOPe Domain Sequences for d5uf4b_:

Sequence; same for both SEQRES and ATOM records:

>d5uf4b_ c.10.2.0 (B:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
cpsqcscsgttvnckskslasvpagiptttrvlylndnqitklepgvfdrlvnlqtlwln
nnqltslpaglfdsltqltilaldsnqlqalpvgvfgrlvdlqqlylgsnqlsalpsavf
drlvhlkellmccnkltelprgierlthlthlaldqnqlksiphgafdrlsslthaylfg
npwdcecrdimylrnwvadhtsivmrwdgkavndpdsakcagtntpvravteastspskc
p

Timeline for d5uf4b_:

• d5uf4b_ first appeared in SCOPe 2.07