SCOPe 2.08: Domain d6noja1: 6noj A:18-134

Lineage for d6noja1 (6noj A:18-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6noja1: 6noj A:18-134 [365206]
   Other proteins in same PDB: d6noja2, d6nojb2
   automated match to d5x8ma_
   complexed with kw7

Details for d6noja1

PDB Entry: 6noj, 2.33 Å

PDB Description: pd-l1 igv domain v76t with fragment

PDB Compounds: (A:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d6noja1:

Sequence; same for both SEQRES and ATOM records:

>d6noja1 b.1.1.0 (A:18-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlktq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapy

Timeline for d6noja1:

• d6noja1 first appeared in SCOPe 2.07