| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
| Protein automated matches [190576] (52 species) not a true protein |
| Species Chlamydia trachomatis [TaxId:471473] [364684] (3 PDB entries) |
| Domain d6nrzb1: 6nrz B:4-163 [365202] Other proteins in same PDB: d6nrza2, d6nrzb2 automated match to d3a74a1 protein/RNA complex; complexed with adn, cl, edo, lys, na, pg4 |
PDB Entry: 6nrz (more details), 2.1 Å
SCOPe Domain Sequences for d6nrzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nrzb1 b.40.4.0 (B:4-163) automated matches {Chlamydia trachomatis [TaxId: 471473]}
eveylqhedylyrtsklkeirdlginpypyqytdclevqeirnqfvdnelgdseaafrke
tpkvrfagrlvlfrsmgknafgqildndakiqvmfnrdfsavaglaadagispikfiekk
ldlgdilglegylffthsgeltvlvetvtllckslislpd
Timeline for d6nrzb1: