Lineage for d1tby__ (1tby -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (16 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (183 PDB entries) 
Domain d1tby__: 1tby - [36520]
Details for d1tby__
PDB Entry: 1tby (more details), 1.77 Å
PDB Description: dissection of the functional role of structural elements of tyrosine- 63 in the catalytic action of human lysozyme
SCOP Domain Sequences for d1tby__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tby__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srlwcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv
SCOP Domain Coordinates for d1tby__:
Click to download the PDB-style file with coordinates for d1tby__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tby__:
- d1tby__ first appeared (with stable ids) in SCOP 1.55
- d1tby__ appears in SCOP 1.59
- d1tby__ appears in SCOP 1.63
- d1tby__ appears in the current release, SCOPe 2.08, called d1tbya_
View in 3D