Lineage for d6nyca_ (6nyc A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2368400Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2368401Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2368651Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2368652Protein automated matches [190497] (4 species)
    not a true protein
  7. 2368687Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (11 PDB entries)
  8. 3065135Domain d6nyca_: 6nyc A: [365197]
    automated match to d3kwta_
    complexed with b3p, cl

Details for d6nyca_

PDB Entry: 6nyc (more details), 1.89 Å

PDB Description: munc13-1 c2b-domain, calcium free
PDB Compounds: (A:) Munc13-1

SCOPe Domain Sequences for d6nyca_:

Sequence, based on SEQRES records: (download)

>d6nyca_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wsakisitvvcaqglqakdktgssdpyvtvqvgktkkrtktiygnlnpvweenfhfechn
ssdrikvrvwdedddiksrvkqrfkresddflgqtiievrtlsgemdvwynldkrtdksa
vsgairlhisvei

Sequence, based on observed residues (ATOM records): (download)

>d6nyca_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wsakisitvvcaqglqakdgssdpyvtvqvgktkkrtktiygnlnpvweenfhfechnss
drikvrvwdedddikesddflgqtiievrtlsgemdvwynldkrvsgairlhisvei

SCOPe Domain Coordinates for d6nyca_:

Click to download the PDB-style file with coordinates for d6nyca_.
(The format of our PDB-style files is described here.)

Timeline for d6nyca_:

  • d6nyca_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-21