Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class omega GST [81352] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47632] (17 PDB entries) |
Domain d6mhbc2: 6mhb C:103-240 [365165] Other proteins in same PDB: d6mhba1, d6mhbb1, d6mhbc1, d6mhbd1, d6mhbe1, d6mhbf1 automated match to d1eema1 complexed with jr7, mes |
PDB Entry: 6mhb (more details), 2.75 Å
SCOPe Domain Sequences for d6mhbc2:
Sequence, based on SEQRES records: (download)
>d6mhbc2 a.45.1.1 (C:103-240) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw qgflelylqnspeacdyg
>d6mhbc2 a.45.1.1 (C:103-240) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} lpddpyekacqkmilelfskvpslvgsfirskedyaglkeefrkeftkleevltnkkttf fggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdwqg flelylqnspeacdyg
Timeline for d6mhbc2: