SCOPe 2.08: Domain d6mhbd1: 6mhb D:6-102

Lineage for d6mhbd1 (6mhb D:6-102)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
Protein Class omega GST [81363] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [52877] (17 PDB entries)
Domain d6mhbd1: 6mhb D:6-102 [365157]
Other proteins in same PDB: d6mhba2, d6mhbb2, d6mhbc2, d6mhbd2, d6mhbe2, d6mhbf2
automated match to d1eema2
complexed with jr7, mes

Details for d6mhbd1

PDB Entry: 6mhb (more details), 2.75 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor 18

PDB Compounds: (D:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d6mhbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mhbd1 c.47.1.5 (D:6-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
arslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewffk
knpfglvpvlensqgqliyesaitceyldeaypgkkl

SCOPe Domain Coordinates for d6mhbd1:

Click to download the PDB-style file with coordinates for d6mhbd1.
(The format of our PDB-style files is described here.)

Timeline for d6mhbd1: