Lineage for d6hn6a_ (6hn6 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
    Uniprot P19793 227-458
  8. Domain d6hn6a_: 6hn6 A: [365118]
    automated match to d1lbda_
    complexed with cps

Details for d6hn6a_

PDB Entry: 6hn6 (more details), 2.71 Å

PDB Description: a revisited version of the apo structure of the ligand-binding domain of the human nuclear receptor rxr-alpha
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d6hn6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hn6a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
sanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewak
riphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvga
ifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayc
khkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt

SCOPe Domain Coordinates for d6hn6a_ are not available.

Timeline for d6hn6a_: