Lineage for d6hl9b_ (6hl9 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404704Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (2 proteins)
    automatically mapped to Pfam PF08943
  6. 2404709Protein automated matches [190931] (3 species)
    not a true protein
  7. 3063167Species Escherichia coli [TaxId:656397] [363229] (2 PDB entries)
  8. 3065054Domain d6hl9b_: 6hl9 B: [365116]
    automated match to d1jr7a_
    complexed with fe2, sin

Details for d6hl9b_

PDB Entry: 6hl9 (more details), 2.3 Å

PDB Description: crystal structure of the csid glutarate hydroxylase in complex with succinate
PDB Compounds: (B:) Protein CsiD

SCOPe Domain Sequences for d6hl9b_:

Sequence, based on SEQRES records: (download)

>d6hl9b_ b.82.2.3 (B:) automated matches {Escherichia coli [TaxId: 656397]}
qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc
anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy
arfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhldd
wehldnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfee
gvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfa
yasnhyqth

Sequence, based on observed residues (ATOM records): (download)

>d6hl9b_ b.82.2.3 (B:) automated matches {Escherichia coli [TaxId: 656397]}
qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc
anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy
arfvvknhrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhp
larrpmrfaappskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietsk
gilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqth

SCOPe Domain Coordinates for d6hl9b_:

Click to download the PDB-style file with coordinates for d6hl9b_.
(The format of our PDB-style files is described here.)

Timeline for d6hl9b_:

  • d6hl9b_ is new in SCOPe 2.07-stable