Lineage for d6h1lb_ (6h1l B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2723142Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2723143Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2723144Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2723269Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. 2723302Species Bacillus megaterium [TaxId:1404] [48269] (106 PDB entries)
    Uniprot P14779
  8. 2723436Domain d6h1lb_: 6h1l B: [365115]
    automated match to d2uwha_
    complexed with dio, edo, fjq, hem, peg, po4, tla

Details for d6h1lb_

PDB Entry: 6h1l (more details), 1.97 Å

PDB Description: structure of the bm3 heme domain in complex with tioconazole
PDB Compounds: (B:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d6h1lb_:

Sequence, based on SEQRES records: (download)

>d6h1lb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdffgdglvtswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkiplgg

Sequence, based on observed residues (ATOM records): (download)

>d6h1lb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdffgdglvtswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgddllthmlngkdp
etgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvp
sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrd
ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
edhtnyeldiketltlkpegfvvkakskkiplgg

SCOPe Domain Coordinates for d6h1lb_:

Click to download the PDB-style file with coordinates for d6h1lb_.
(The format of our PDB-style files is described here.)

Timeline for d6h1lb_: