Lineage for d6hl9a_ (6hl9 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (2 proteins)
    automatically mapped to Pfam PF08943
  6. Protein automated matches [190931] (3 species)
    not a true protein
  7. Species Escherichia coli [TaxId:656397] [363229] (2 PDB entries)
  8. Domain d6hl9a_: 6hl9 A: [365108]
    automated match to d1jr7a_
    complexed with fe2, sin

Details for d6hl9a_

PDB Entry: 6hl9 (more details), 2.3 Å

PDB Description: crystal structure of the csid glutarate hydroxylase in complex with succinate
PDB Compounds: (A:) Protein CsiD

SCOPe Domain Sequences for d6hl9a_:

Sequence, based on SEQRES records: (download)

>d6hl9a_ b.82.2.3 (A:) automated matches {Escherichia coli [TaxId: 656397]}
qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc
anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy
arfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhldd
wehldnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfee
gvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfa
yasnhyqth

Sequence, based on observed residues (ATOM records): (download)

>d6hl9a_ b.82.2.3 (A:) automated matches {Escherichia coli [TaxId: 656397]}
qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc
anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy
arfvvknylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldn
yfrhplarrpmrfaappskdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsda
ietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqth

SCOPe Domain Coordinates for d6hl9a_ are not available.

Timeline for d6hl9a_:

Domains from other chains:
(mouse over for more information)
d6hl9b_